DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and F57B7.2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:195 Identity:48/195 - (24%)
Similarity:71/195 - (36%) Gaps:57/195 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT-PRFKFSGQN 163
            ||.||..|.:..:.|            |.|.|||.:||  ||...:.| |:.|.. |.....|:|
 Worm   159 LDAHNECRQRYGNEN------------LCWSTELAEMA--HAWAVKLA-DRGRVLYPELPGIGEN 208

  Fly   164 IGYFWIGREF--KSHSRRMKSFVINWFREHQDANQSFID----RYHPHPQGKKIGHFTLLVSDRV 222
            :    |.:|.  :||....:..:..|.:|.|     |.|    |::|     |...|:.:|....
 Worm   209 L----ILKEANEQSHLPTGQEVIQEWEKEAQ-----FFDFDKPRWNP-----KCQRFSQVVWKDT 259

  Fly   223 NRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLCDWRDAN 287
            ..:|.|  |:....:|  ...:.|.|             .|||:.......:...||    ||.:
 Worm   260 TELGAA--RYWNTANN--CVAVVCFY-------------RPAGNSNAPGEFASNVPS----RDCS 303

  Fly   288  287
             Worm   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/155 (26%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.