DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-11

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502499.1 Gene:scl-11 / 186050 WormBaseID:WBGene00009892 Length:207 Species:Caenorhabditis elegans


Alignment Length:223 Identity:50/223 - (22%)
Similarity:80/223 - (35%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNL----DGYRSAAHMPLLRWDTE 132
            |...|.||          :.:...:|.::|.||..||.||.|..    ...:|.::|..::||..
 Worm     9 CCIAGVFS----------QFTSTGQQAIVDAHNKLRSSIAKGTYVAKGTTQKSGSNMRKIKWDAT 63

  Fly   133 LEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFW----IGR--------------EFKSHSRR 179
            :...|..:|..|...|.:...      .|:|:.::|    ||.              ||:.:...
 Worm    64 VATSAQNYANTCPTGHSQGSG------YGENLYWYWTSGTIGNLDTFGPAASSSWESEFQQYGWT 122

  Fly   180 MKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFL--EPKSNRFQF 242
            ..:..:|.|                   ...|||.|.:.......:|| ||:..  :|.:...:.
 Worm   123 SNTLDMNTF-------------------NTGIGHATQMAWANTFAIGC-GVKNCGKDPSNGYNKV 167

  Fly   243 MLTCNYDY-NNIFNEPIYQSGPAGSKCP 269
            .:.|.|.. .|..|:||||.|...:.||
 Worm   168 AVVCQYKTPGNYLNQPIYQQGTTCAACP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 36/176 (20%)
scl-11NP_502499.1 SCP 21..173 CDD:214553 36/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.