DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-9

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502497.1 Gene:scl-9 / 186048 WormBaseID:WBGene00009890 Length:213 Species:Caenorhabditis elegans


Alignment Length:202 Identity:58/202 - (28%)
Similarity:86/202 - (42%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LLDMHNLARSKIASGNLD--GYR--SAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKF 159
            ||::||..||::|.|.|.  |.:  ||:.|..:.|..:|...|...|:.|...|....||     
 Worm    28 LLNVHNEFRSQLALGQLSFRGVKKPSASMMRKISWSKKLTNAATKFAETCPKNHSVVMNT----- 87

  Fly   160 SGQNIGYFWIGREFKSHSRRMKSFVI----NWFREHQ-DANQSFIDRYHPHPQGKKIGHFTLLVS 219
             |::|  ||   .|.|.....:.:..    .|:.|.: :...|.|  |:...|..:|||...:..
 Worm    88 -GESI--FW---HFSSSLSTPEQYATLAPQKWWNEFETNGWDSLI--YNHASQRFQIGHAVQMAW 144

  Fly   220 DRVNRVGCAGVRFLEPKSNRFQFMLTCNY-DYNNIFNEPIYQSGPAGSKCPQHRISEKFPS-LCD 282
            ...::||| |.......:.....::.|.| ...||..||||..|...:|||:.  .:|.|| ||:
 Worm   145 HTTSKVGC-GYSKCAVGTPEQTMVVVCRYFQKGNIEGEPIYNEGETCTKCPEE--YQKCPSGLCE 206

  Fly   283 WRDANND 289
            ......|
 Worm   207 KEGVETD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 42/159 (26%)
scl-9NP_502497.1 SCP 23..174 CDD:214553 42/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.