DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-14

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502532.1 Gene:scl-14 / 184246 WormBaseID:WBGene00008625 Length:208 Species:Caenorhabditis elegans


Alignment Length:193 Identity:48/193 - (24%)
Similarity:79/193 - (40%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LLDMHNLARSKIASGNLDGYRSAAH----MPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKF 159
            :|::||..||:||.|......:..|    |..::|...|...:.::|.||...|......     
 Worm    27 ILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHSNMIGV----- 86

  Fly   160 SGQNIGYFWIGREFKSHSRRMKSFVINWFREHQD----ANQSFIDRYHPHPQGKKIGHFTLLVSD 220
             |:|:.::|......:..:........|.:|.||    :|...:..::     ..:||.|.:...
 Worm    87 -GENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFN-----SGVGHATQMAWA 145

  Fly   221 RVNRVGCAGVRFLEPKSNRF-QFMLTCNYD-YNNIFNEPIYQSGPAGSKCPQHRISEKFPSLC 281
            :.|.:|| ||:.....:|.. :..:.|:|. ..|..|:.||.||...||||.....|....||
 Worm   146 KTNLIGC-GVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSCEAATGLC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 34/158 (22%)
scl-14NP_502532.1 SCP 22..175 CDD:214553 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.