DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-15

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_494496.1 Gene:scl-15 / 184099 WormBaseID:WBGene00017183 Length:207 Species:Caenorhabditis elegans


Alignment Length:213 Identity:50/213 - (23%)
Similarity:80/213 - (37%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASG----NLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDK 150
            :.|:..::.::|.||..||.||.|    |.......:::..::||..:.:.|..:|..|...|.|
 Worm    18 QFSKAGQKAIVDAHNTLRSSIAKGTYVANKTRKEPGSNILKMKWDPTIAKSAQAYANTCPTGHGK 82

  Fly   151 CRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN----WFREHQDANQSFIDRYHPHPQGKK- 210
            .:       .|:|:.:.|.|...||    :..:.:.    |..|.|        :|     |.| 
 Worm    83 SK-------YGENLYWRWSGAVIKS----IDDYGVRASGAWASEFQ--------KY-----GWKT 123

  Fly   211 -----------IGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGP 263
                       |||.|.:.......:||........|:..::..:.|.|. ..|:.|..||.:|.
 Worm   124 NKLDSALFKTGIGHATQMAWASTGSIGCGVKNCGMDKNKMYKVAVVCQYSARGNMINNNIYTAGK 188

  Fly   264 AGSKCPQHRISEKFPSLC 281
            ..|.||.....||...||
 Worm   189 TCSACPAKTKCEKATGLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 36/172 (21%)
scl-15NP_494496.1 SCP 22..173 CDD:214553 36/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.