DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-26

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_504963.1 Gene:scl-26 / 183662 WormBaseID:WBGene00016821 Length:208 Species:Caenorhabditis elegans


Alignment Length:215 Identity:44/215 - (20%)
Similarity:78/215 - (36%) Gaps:58/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASG-----NLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHD 149
            |.:|...:.|:.:||..|:..:.|     |:.   .:..|..|.|:..|    ...||...:..|
 Worm    21 EWNETAIEGLVFVHNKLRNDASQGLWARHNIS---KSTDMQKLFWNNSL----VAEAKHEMYDCD 78

  Fly   150 KCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHF 214
            :...  |....|:|| |.:....:.....:.....||  ::..||..|          ..:...:
 Worm    79 QLEK--RELTLGENI-YQYDVTTYDDVDGQQGEAAIN--KDSHDALSS----------KDQAAQY 128

  Fly   215 TL--LVSDRVNRVGC----------AGVRFLEPKSNRFQFMLTCNYD--YNNIFNEPIYQSG--- 262
            .|  ::..:.|.:||          .|..:    :.||   :.|.|.  ..|| ::.:|:.|   
 Worm   129 RLRQILYSKSNSIGCIYESCDRIDDEGTNY----NTRF---IICKYSPALKNI-DDQLYEEGEEA 185

  Fly   263 ----PAGSKC--PQHRISEK 276
                |:|:.|  |..::.||
 Worm   186 CSNCPSGTSCTDPMMKLCEK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 31/169 (18%)
scl-26NP_504963.1 CAP_euk 30..168 CDD:349399 31/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.