DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-8

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502510.1 Gene:scl-8 / 183345 WormBaseID:WBGene00008030 Length:210 Species:Caenorhabditis elegans


Alignment Length:204 Identity:59/204 - (28%)
Similarity:91/204 - (44%) Gaps:23/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASGN--LDGYR--SAAHMPLLRWDTELEQMAALHAKRCQFAHDK 150
            :.||..:|.:|:.||..||:||.||  ..|.|  ||.:|..::||:.|||.|..:|..|...|  
 Worm    17 QFSEGGKQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQH-- 79

  Fly   151 CRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQ----DANQSFIDRYHPHPQGKKI 211
               :...|..|:|:.:.|.|..|....:..|...:.|..|.:    ::|:..:..::     ..:
 Worm    80 ---STNDKTIGENLYWEWSGDPFSDLDKFGKIATVAWDHEFEQFGWNSNKFSLALFN-----TGV 136

  Fly   212 GHFTLLVSDRVNRVGCAGVRFLEPKSNR---FQFMLTCNYDY-NNIFNEPIYQSGPAGSKCPQHR 272
            .|.|.:......::|| ||:.....:.|   ||..:.|.|.. .|.|.:.||.||...|.||...
 Worm   137 AHATQIAWAPTGKIGC-GVKNCGRDARRGGLFQVAIVCQYRVRGNFFFKNIYNSGATCSACPAGT 200

  Fly   273 ISEKFPSLC 281
            ..|:...||
 Worm   201 SCEQSTGLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 44/163 (27%)
scl-8NP_502510.1 SCP 22..175 CDD:214553 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3709
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.