DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-6

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502508.1 Gene:scl-6 / 183343 WormBaseID:WBGene00008028 Length:209 Species:Caenorhabditis elegans


Alignment Length:212 Identity:48/212 - (22%)
Similarity:87/212 - (41%) Gaps:42/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASG--NLDGYRSAA--HMPLLRWDTELEQMAALHAKRCQFAHDK 150
            |.|...:|.::|:||..|||:|:|  :::|....|  ::..:.||:.|...|..:|..|......
 Worm    19 EFSSSTQQFIVDLHNSFRSKLATGTYSINGTLKPAGSNIRKMSWDSTLATSAQTYANTCPTGFSN 83

  Fly   151 CRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSF-------VINWFREHQD-------ANQSFIDR 201
            .:.|      |:|:  :|     ::.|..:...       .::|.:|.|.       .:|...| 
 Worm    84 TQGT------GENL--YW-----RTTSANISGLDIYGGAASVSWEQEFQKYGWATNYFSQELFD- 134

  Fly   202 YHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRF-QFMLTCNY-DYNNIFNEPIYQSGPA 264
                   ..:|:.|.:...:.|.||| ||:.....|... :..:.|:| ......::.||.:|..
 Worm   135 -------TGVGNGTQMAWAKTNLVGC-GVKNCGKDSTGLNKVAVVCHYKPLGRYVDQMIYTAGFT 191

  Fly   265 GSKCPQHRISEKFPSLC 281
            .|:||.....::...||
 Worm   192 CSQCPTGTSCDQTTGLC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 38/172 (22%)
scl-6NP_502508.1 SCP 23..176 CDD:214553 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.