DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and C07A4.3

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:132 Identity:30/132 - (22%)
Similarity:54/132 - (40%) Gaps:8/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKS 182
            ||:....|.:..|:.|..:|...:....| |.||....:....|:|:..| ...:|.|......:
 Worm    55 YRAHHSSPAVTVDSNLTNLAQKWSDEMAF-HKKCLVHEQPSKYGENLTSF-ASSKFPSPKTCAAA 117

  Fly   183 FVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCN 247
            .:..::.|....|.:   |::| ....|:||||.|:.....::| .||. :..:...:...:...
 Worm   118 LIHGFYTEGYGFNYT---RFNP-GSWSKVGHFTQLLWKNSRKIG-VGVS-VAKRGTMYHVYVCIK 176

  Fly   248 YD 249
            ||
 Worm   177 YD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 28/130 (22%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.