DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-23

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_499859.3 Gene:scl-23 / 182028 WormBaseID:WBGene00015246 Length:330 Species:Caenorhabditis elegans


Alignment Length:230 Identity:55/230 - (23%)
Similarity:88/230 - (38%) Gaps:44/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LEMSERRRQLLLDMHNLARSKIASGNL---DGYRSAA-HMPLLRWDTELEQMAALHAKRCQFAHD 149
            |.:..|.:.|:||.||..||::|.|..   |.|...| :|..|.||.|||..|...|::|....:
 Worm   115 LNLPARLQNLILDKHNEIRSQVALGQYAVDDDYLPPADNMVKLDWDCELELEAQQRAQQCNLQKE 179

  Fly   150 KCRNTPR-----FKFSGQNIGYFWI-------GREFKSHSRRMKSFVINWFREHQDANQSFIDRY 202
               |:.|     .:..|:|..||..       |...|...|......|...:..:      :.||
 Worm   180 ---NSGRQMNGWDEVRGENAFYFRTTDGLDVSGAVLKGIQRMGDEIAIAGIKNLK------LSRY 235

  Fly   203 HPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSN------RFQFMLTCNYDYNNIFNE----P 257
                 ..:|||.|.::.....::||| |:....:.:      ::...:...|...|:|..    .
 Worm   236 -----DSRIGHATQILWKETRKLGCA-VQECPARQDGSLDGQKYNVAVCKYYPTGNVFKSSTPTS 294

  Fly   258 IYQSGPAGSKCPQHRISEKFPSLC---DWRDANND 289
            ||..|...|.|.:....:....||   .|::.:.:
 Worm   295 IYSVGDVASACSEGTFGDPSTGLCVAATWQEGSKE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 42/174 (24%)
scl-23NP_499859.3 CAP_euk 122..281 CDD:349399 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157362
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.