DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and vap-2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:259 Identity:74/259 - (28%)
Similarity:107/259 - (41%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CAAALCELYNGTHLVHVPHTAC-------GNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARS 108
            |....|..|.|:..: ||...|       .:.|||.  |  :..|  :|:..|...|:.||..||
 Worm   271 CEDKDCFTYPGSKCL-VPEGLCQAPSMVKDDGGSFQ--C--DNSL--VSDVTRNFTLEQHNFYRS 328

  Fly   109 KIASG---NLDGYRS---AAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYF 167
            ::|.|   |.:...|   |:.|..:.:|..||:.|...|..|.|||......|.   .|||: |.
 Worm   329 RLAKGFEWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPN---QGQNL-YM 389

  Fly   168 WIGREFKSHSRR--MKSFVINWFREHQDANQSFIDRYHPH---PQGKKIGHFTLLVSDRVNRVGC 227
               ..|.:...|  :.:.|..|::|.::......:...|.   .:||.|||:|.:..||..|:||
 Worm   390 ---SSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGC 451

  Fly   228 AGVRFLEPKSNRFQFMLTCNY-DYNNIFNEPIYQSG---------PAGSKCPQHRISEKFPSLC 281
             |:... ||.:    .:.|:| ...|..|..||:.|         |.|:.|      ||..|||
 Worm   452 -GIANC-PKMS----YVVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDC------EKTTSLC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 48/164 (29%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 48/165 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.