DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-13

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:207 Identity:51/207 - (24%)
Similarity:83/207 - (40%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASGNLDGY-------RSAAHMPLLRWDTELEQMAALHAKRCQFA 147
            :.|...:..::|.||..||.||.|:   |       .||::|..:.||..:...|..:|:.|...
 Worm    17 QFSSTAQGQIVDAHNKLRSAIAQGS---YVAAGTQEPSASNMRKIVWDETVAAAAQEYAEGCPDD 78

  Fly   148 HDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDA--NQSFIDRYHPHPQG-- 208
            |....       .|:|:.:.|......|..:...:...:|..|.|..  ..:|:|.     .|  
 Worm    79 HSGTS-------YGENLYWSWSSSAPSSLDKFGVAASNSWESEFQKYGWTSTFLDE-----AGFA 131

  Fly   209 KKIGHFTLLVSDRVNRVGCAGVRFL---EPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269
            ..|||.|.:.....:::|| |::..   ..|.|.::..:.|.|| ..|:.:..|||.|...|.|.
 Worm   132 TGIGHATQMAWAETSKIGC-GIKNCGKDANKKNMYKVAVVCQYDSAGNMMDSDIYQQGETCSACS 195

  Fly   270 QHRISEKFPSLC 281
            :....|:...||
 Worm   196 EDASCEQDSGLC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 38/166 (23%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 38/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.