DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-3

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502504.1 Gene:scl-3 / 178252 WormBaseID:WBGene00009896 Length:211 Species:Caenorhabditis elegans


Alignment Length:203 Identity:53/203 - (26%)
Similarity:78/203 - (38%) Gaps:22/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASGN--LDGYRSAAHMPLL--RWDTELEQMAALHAKRCQFAHDK 150
            :..|..:|.::|:||..|:.||.|.  ..|...||...||  :|||.|...|...|..|...|..
 Worm    19 QFRESTQQFIVDLHNKLRTSIAKGTYVAKGTTKAAGSNLLKMKWDTTLATAAQTFANTCPRGHSN 83

  Fly   151 CRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQD---ANQSFIDRYHPHPQGKKIG 212
            ....      |:|:.:.|....|........:..:.|.:|.|.   ...:|....    ....||
 Worm    84 AAGV------GENLYWRWSSLPFSGMDIYGGAASVAWEQEFQQYGWTTNTFTQAL----ANTGIG 138

  Fly   213 HFTLLVSDRVNRVGCAGVRFL--EPKSNRF-QFMLTCNYD-YNNIFNEPIYQSGPAGSKCPQHRI 273
            |.|.:.......:|| ||:..  :|:.|.: :.::.|.|. ..|...:.||:||...|.||....
 Worm   139 HATQMAWANTGLIGC-GVKNCGPDPELNNYNRAVVVCQYKAQGNYLGQDIYKSGTTCSACPTGTT 202

  Fly   274 SEKFPSLC 281
            .|....||
 Worm   203 CEAATGLC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/162 (25%)
scl-3NP_502504.1 SCP 23..176 CDD:214553 40/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.