DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_502503.1 Gene:scl-2 / 178251 WormBaseID:WBGene00009895 Length:207 Species:Caenorhabditis elegans


Alignment Length:193 Identity:52/193 - (26%)
Similarity:80/193 - (41%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LLDMHNLARSKIASGN--LDGYRSAAHMPLL--RWDTELEQMAALHAKRCQFAHDKCRNTPRFKF 159
            :::.||..|||||.|.  ..|.:.:....||  :||:.:...|..:|..|...|......     
 Worm    26 IINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHSGDAGL----- 85

  Fly   160 SGQNIGYFWIGREFKSHSRRMKSFVINWFREHQD----ANQSFIDRYHPHPQGKKIGHFTLLVSD 220
             |:|:.::|........::...:...:|.:|.||    :|...||.::     ..|||.|.:...
 Worm    86 -GENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFN-----TGIGHATQMAWA 144

  Fly   221 RVNRVGCAGVRFLEPKSNRF-QFMLTCNY-DYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLC 281
            :.|.:|| ||:.....||.. :..:.|.| ...|..|:.||.||...|.||.....|....||
 Worm   145 KSNLIGC-GVKDCGRDSNGLNKVTVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCETSTGLC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/159 (25%)
scl-2NP_502503.1 SCP 21..174 CDD:214553 40/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14643
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.