DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crispld2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:269 Identity:68/269 - (25%)
Similarity:106/269 - (39%) Gaps:68/269 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CGNNGSFSPACGPEPKLLE----------------MSERRRQLLLDMHNLARSKIASGNLDGYRS 120
            ||....|.|......:||.                ||:|:..|:|  ||..|.::       |..
  Rat    18 CGVQAFFLPNTMSLERLLSKYQHTEPHSRVRRAIPMSDRQEILML--HNKLRGQV-------YPP 73

  Fly   121 AAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVI 185
            |::|..:.||.|||:.||..|:||.:.|.........   |||:...| || ::|....::|   
  Rat    74 ASNMEYMTWDEELERSAAAWAQRCLWEHGPASLLVSI---GQNLAVHW-GR-YRSPGFHVQS--- 130

  Fly   186 NWFREHQDANQSFIDRYHPHP-----------QGKKIGHFTLLVSDRVNRVGCA--GVRFLEPKS 237
             |:.|.:|..       :|:|           .|....|:|.:|....|::|||  ..|.:....
  Rat   131 -WYDEVKDYT-------YPYPHECNPWCPERCSGAMCTHYTQMVWATTNKIGCAVHTCRSMSVWG 187

  Fly   238 NRFQ--FMLTCNYD-YNNIFNEPIYQSGPAGSKCPQHRISEKFPSLCDWR----------DANND 289
            :.::  ..|.|||. ..|...|..|:.|...|:||.........:|| :|          |..|:
  Rat   188 DIWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCRNNLC-YREEHYHQKPEVDEMNE 251

  Fly   290 LDSEESDED 298
            ::|..:.|:
  Rat   252 VESPPAPEE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 44/167 (26%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 45/169 (27%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.