DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CRISP1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:211 Identity:44/211 - (20%)
Similarity:77/211 - (36%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC--RNTPRFKFSG 161
            ::::||..|.::..       .|::|..:.|..|..|.|.:.:|.|.......  |..|. .|.|
Human    44 IVNIHNALRRRVVP-------PASNMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPN-TFCG 100

  Fly   162 QNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIG------------HF 214
            :|:              .|.|:.::|        .|.|..::......|.|            |:
Human   101 ENM--------------HMTSYPVSW--------SSVIGVWYSESTSFKHGEWTTTDDDITTDHY 143

  Fly   215 TLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYN----NIFNEPIYQSGPAGSKCPQHRISE 275
            |.:|......:|||.....:..|.|:.::  |:|.:.    ...||| |::|.....||.:...:
Human   144 TQIVWATSYLIGCAIASCRQQGSPRYLYV--CHYCHEGNDPETKNEP-YKTGVPCEACPSNCEDK 205

  Fly   276 KFPSLCDWRDANNDLD 291
            ...:.|.:.|...|.|
Human   206 LCTNPCIYYDEYFDCD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 32/163 (20%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 33/164 (20%)
Crisp 195..249 CDD:285731 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.