DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG43777

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:118/264 - (44%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LIETITTTTPASSG-GYC--AAALCELYNGTH-LVHV-PHTACGNNGSFSPACGPEPKLLEMSER 94
            |:..:....|.:|| .||  ....|.|....| :.|: ..|..||:..|..:       :..:.|
  Fly     5 LLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHAS-------VPNNMR 62

  Fly    95 RRQLLLDMHNLARSKIASGNL-----DGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT 154
            .:::.||:.|..|:|.|.|.|     ..:..|..|..|.||.||..|...||........:||:|
  Fly    63 MQKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQCRST 127

  Fly   155 PRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDAN--QSFIDRYHPHPQGKKIGHFTLL 217
            .||...|:.|.......:........|:|. ..|.|:|..:  .:.:..:.| .:..::.|||.:
  Fly   128 LRFPHVGEAIALVTPREKLNLKEIYSKAFT-PMFAEYQHVSDPDALLHAFDP-DRDFQVRHFTNI 190

  Fly   218 VSDRVNRVGCAGVRF---LEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKCPQHRI--SEKF 277
            :||||:|||| ||..   ..| |.:|...|||.:|::|:....:|::|...|.|....:  |:|:
  Fly   191 ISDRVSRVGC-GVAVGANCNP-SIKFCHFLTCYFDFHNMAGSYVYKAGDPTSSCDDWGVVSSDKY 253

  Fly   278 PSLC 281
            .:||
  Fly   254 ANLC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 50/162 (31%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 50/162 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440503
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
65.950

Return to query results.
Submit another query.