DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:288 Identity:67/288 - (23%)
Similarity:98/288 - (34%) Gaps:86/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AQTLIETITTTTPASSGGYCAAALCELY---NGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSE 93
            ||:|        |.:.||.....||||:   .|:.|          |..|.|   .|..:..::|
Human    13 AQSL--------PLAVGGVLKLRLCELWLLLLGSSL----------NARFLP---DEEDVDFINE 56

  Fly    94 RRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAH-----DKCRN 153
                 .:::||..|.       |.....:::..:.||..|.:.|....|:|.|.|     |....
Human    57 -----YVNLHNELRG-------DVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMV 109

  Fly   154 TPRFKFSGQNIGYFWIG--REFKSHSRRMKSFVI-NWFREHQDANQSFIDRYHPHPQGKKIG--- 212
            .|:|...|:|:   |:|  .||.:      |..| :|..|.:..|         ...|...|   
Human   110 HPKFYGIGENM---WVGPENEFTA------SIAIRSWHAEKKMYN---------FENGSCSGDCS 156

  Fly   213 HFTLLVSDRVNRVGCAGVRFLEPKSNRFQF----MLTCNYDYNNIFNEPIYQSGPAGSKCPQHRI 273
            ::..||.|...:||||    :.|.|.....    :..|||..........|:.|           
Human   157 NYIQLVWDHSYKVGCA----VTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPG----------- 206

  Fly   274 SEKFPSLCDWRDANNDLDSEESDEDGNT 301
              .|.:.|..||...|.....:|.|..|
Human   207 --IFCTRCGRRDKCTDFLCSNADRDQAT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 39/167 (23%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 41/176 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.