DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crisp3

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:208 Identity:42/208 - (20%)
Similarity:70/208 - (33%) Gaps:55/208 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PKLLEMSERRRQL-------------LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMA 137
            |.||:.:.:...|             ::..||..|.|::.       |.:.:..:.|:.:.:..|
Mouse    16 PSLLQDNSQENSLEKLSTSKKSVQEEIVSKHNQLRRKVSP-------SGSDLLNMEWNYDAQVNA 73

  Fly   138 ALHAKRCQFAHDKCR-NTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDR 201
            ...|.:|.|:|.... .|...| .|:|:       ...|:.....|.:..|:.|    ::..|..
Mouse    74 QQRADKCTFSHSPIELRTTNLK-CGENL-------FMSSYLVPWSSVIQGWYNE----SKGLIFG 126

  Fly   202 YHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGS 266
            ..|......:||.|.:|.....:|.| ||  .|...|..::...|.|                  
Mouse   127 VGPKQNVSVVGHHTQVVWKSNLQVAC-GV--AECPENPLRYFYVCRY------------------ 170

  Fly   267 KCPQHRISEKFPS 279
             ||....|..:||
Mouse   171 -CPVLNYSGHYPS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 33/166 (20%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 33/175 (19%)
Crisp 194..241 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.