DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and GLIPR1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_006842.2 Gene:GLIPR1 / 11010 HGNCID:17001 Length:266 Species:Homo sapiens


Alignment Length:197 Identity:59/197 - (29%)
Similarity:83/197 - (42%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 MHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT---------PRF 157
            :||..||::..       :|:.|..:.||..|.|:|...|..|||:|    ||         |.|
Human    40 IHNKFRSEVKP-------TASDMLYMTWDPALAQIAKAWASNCQFSH----NTRLKPPHKLHPNF 93

  Fly   158 KFSGQNIGYFWIGRE--FKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKI-GHFTLLVS 219
            ...|:||   |.|..  |.     :.|.:.||:.|.||  ..|..|.     .||: ||:|.:|.
Human    94 TSLGENI---WTGSVPIFS-----VSSAITNWYDEIQD--YDFKTRI-----CKKVCGHYTQVVW 143

  Fly   220 DRVNRVGCAGVRFLEPKSNRFQFM-----LTCNYDYNNIFNEPIYQSGPAGSKCPQHRISEKFPS 279
            ....:|||| |:|. ||.:.|..:     ..|||.....:....|:.|...|.||.:  .:...:
Human   144 ADSYKVGCA-VQFC-PKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNN--DKCLDN 204

  Fly   280 LC 281
            ||
Human   205 LC 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 51/163 (31%)
GLIPR1NP_006842.2 SCP_GLIPR-1_like 32..178 CDD:240185 52/165 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151248
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.