DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and glipr1a

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:246 Identity:69/246 - (28%)
Similarity:101/246 - (41%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 TACGNNGSFSPACGPEPKLLEMSERRRQLLLD----MHNLARSKIASGNLDGYRSAAHMPLLRWD 130
            :||...|.||     ...|.::::|   ..:|    .||..||.::.       :||:|..:.||
Zfish    10 SACFLLGVFS-----SEYLFDITDR---AFIDECVREHNQNRSSVSP-------TAANMRYMTWD 59

  Fly   131 TELEQMAALHAKRCQFAH-----DKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFRE 190
            ..|...|...|:.|.|.|     :..|..|.|...|:||   |.|..:...:  :||.|.:|..|
Zfish    60 AALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENI---WAGAPYSRFT--VKSAVFSWVNE 119

  Fly   191 HQDANQSFIDRYHPHPQGKKI-GHFTLLVSDRVNRVGCA------GV---RFLEPKSNRFQFMLT 245
            .:|.|.:     :.....||: ||:|.:|.....:||||      ||   .|    ||....:..
Zfish   120 LKDYNYN-----NNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHF----SNIQGVIFV 175

  Fly   246 CNY-DYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLCDWRDANNDLDSEES 295
            ||| ...|......|:.|.:.|.|......|:  :||    .|.|.|:|:|
Zfish   176 CNYATAGNFAGRSPYKQGASCSGCGGSDKCER--NLC----RNTDRDAEQS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 49/172 (28%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.