DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CRISP3

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:199 Identity:43/199 - (21%)
Similarity:74/199 - (37%) Gaps:34/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCR 152
            ||....:.::.:::.||..|..::.       .|.:|..:.|:.|....|...|.:|.:.|...:
Human    62 LLTTQTQVQREIVNKHNELRRAVSP-------PARNMLKMEWNKEAAANAQKWANQCNYRHSNPK 119

  Fly   153 NTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLL 217
            :.......|:|:   ::.....|.|:.::|    ||.|:.|    |.....|......:||:|.:
Human   120 DRMTSLKCGENL---YMSSASSSWSQAIQS----WFDEYND----FDFGVGPKTPNAVVGHYTQV 173

  Fly   218 VSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY----DYNNIFNEPIYQSGPAGSKCPQHRISEKFP 278
            |......|||.....  |.....::...|.|    ::.|....|..|..|..| ||.:       
Human   174 VWYSSYLVGCGNAYC--PNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCAS-CPDN------- 228

  Fly   279 SLCD 282
              ||
Human   229 --CD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 32/156 (21%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.