DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and LOC101883528

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:218 Identity:54/218 - (24%)
Similarity:96/218 - (44%) Gaps:40/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT 154
            :::|:....::|:||..||::..       |||.|..:.||..:..:|..:|.:|.:.|:     
Zfish    22 QLTEQEILNIVDLHNELRSQVQP-------SAAFMQKVVWDETIRLVAEGYAAKCIWDHN----- 74

  Fly   155 PRFKF--SGQNIGYFWIGR-EFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTL 216
            |..:.  .|:|:   ::|. .|.:     ...|::||.|:.|.|.:..|    ..:.|..||:|.
Zfish    75 PDLEHLTMGENL---FVGTGPFNA-----TKAVMDWFNENLDYNYNTND----CAEDKMCGHYTQ 127

  Fly   217 LVSDRVNRVGCAGVRFLEPKSNRFQF----MLTCN-YDYNNIFNEPIYQSGPAGSKCPQH----- 271
            ||.....::|||.  :......:..|    :|.|: |...||..:..|:||.:.||||:.     
Zfish   128 LVWANTTKIGCAS--YFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCPEECENNI 190

  Fly   272 -RISEKFPSLCDWRDANNDLDSE 293
             .:...||...|....:..:.:|
Zfish   191 CVMENLFPPFEDTDPKSTQMSTE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 39/160 (24%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 39/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.