DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG42764

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster


Alignment Length:117 Identity:24/117 - (20%)
Similarity:34/117 - (29%) Gaps:51/117 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 CQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSH----SRRMKSFVINWFREHQDANQSFIDRYH- 203
            |:|..::|             .|:|......|:    .||.|            ..||..|::. 
  Fly    97 CEFIRNEC-------------VYYWASEGAASYGIAKERRTK------------VEQSLADKFSA 136

  Fly   204 --------------PHPQGKKIGHFTLLV--SDRVNRVG-----CAGVRFLE 234
                          |..:.||.|...|:|  |...|:.|     .....|||
  Fly   137 ITWKSTTEMGVGWAPKDRSKKGGRKILVVRYSPAGNQPGEYAENIGDTEFLE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 24/117 (21%)
CG42764NP_001189140.1 SCP 22..172 CDD:294090 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.