DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and LOC101732829

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_017949574.2 Gene:LOC101732829 / 101732829 -ID:- Length:290 Species:Xenopus tropicalis


Alignment Length:230 Identity:57/230 - (24%)
Similarity:88/230 - (38%) Gaps:57/230 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC--RNTPRFK 158
            ||:::|:||..|..:..       :|.:|..:.|:.|..:.|.:.|:.|...|:..  ||...|.
 Frog    82 RQIIVDVHNRWRGNVTP-------TAMNMLKMEWNDEAAKKAEIWARTCNQFHNPASQRNITNFS 139

  Fly   159 FSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVN 223
             .|||:       ...|:|...::.|..||.|.:|    |.....|...|..|||:|........
 Frog   140 -CGQNL-------FMASYSTTWEAAVTAWFDEIKD----FDFGKGPKTFGALIGHYTQGAWYNSR 192

  Fly   224 RVGCAGVRFLEPKSNRFQFMLTCNY-DYNNIFNEPI--YQSGPAGSKCPQ------------HRI 273
            .|||  ..|..|.: .:::...|:| ...||..:..  |:.||....||:            |.|
 Frog   193 MVGC--YEFECPNA-EYRYYYVCHYCPAGNIEGKQFTPYKIGPTCGDCPKSCENGVCTNYCPHPI 254

  Fly   274 S-------------EKFPSLCD-----WRDANNDL 290
            :             .|:|.|.|     .|..||::
 Frog   255 NYDNCQELTTKYSCSKYPELQDDCPAHCRCTNNEI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 41/155 (26%)
LOC101732829XP_017949574.2 CAP 80..217 CDD:412178 41/156 (26%)
Crisp 234..289 CDD:400739 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.