DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and LOC100536500

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:205 Identity:47/205 - (22%)
Similarity:78/205 - (38%) Gaps:48/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKR 143
            |.||.......|:|..::: ::|:||..|..:..       ||::|..:.|...:.:.|.....:
Zfish    24 SAACSVTGVCTELSSVQQE-IVDVHNAFRRAVQP-------SASNMLKMSWSDAVAESARGWINK 80

  Fly   144 CQFAHDKCRNTPRFKF-----SGQNIGYFWIGREFKSHSRRMKSFVIN-WFREHQDANQSFIDRY 202
            |...|    ..|..:.     .|:|:        ||:......:.|:: |   |.:.|.      
Zfish    81 CNMTH----GPPSSRMLNGYEMGENL--------FKATGISSWTSVVDAW---HSEVNN------ 124

  Fly   203 HPHP----QGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDY--NNIFNEPIYQS 261
            :.:|    .|:..||:|.:|......||||   ..:..||.|   ..|:| |  .|....|.|..
Zfish   125 YKYPIGSINGQATGHYTQVVWYSSYEVGCA---VTQCGSNYF---YGCHY-YRAGNFRTVPPYSL 182

  Fly   262 GPAGSKCPQH 271
            |...:.||.:
Zfish   183 GSPCASCPNN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 34/162 (21%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.