DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and LOC100497187

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_017945658.1 Gene:LOC100497187 / 100497187 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:165 Identity:36/165 - (21%)
Similarity:61/165 - (36%) Gaps:48/165 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMP 125
            |..|:....:.|   .:|....|.:..|.:..      .|:.||            .||...::|
 Frog    42 GLFLLSTEFSTC---SAFPSRRGADENLFQTQ------FLEAHN------------KYRKKHNVP 85

  Fly   126 LLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN---- 186
            .:|.:.||.:.|...|... .:.:|.:::..   .|:|:.|        |:|.|.::...|    
 Frog    86 PMRLNAELSKSAQTWANHL-LSINKMQHSGA---GGENLYY--------SYSSRGRTLAGNVAVD 138

  Fly   187 -WFREHQDANQSFIDRYHPHPQGKK--IGHFTLLV 218
             |:.|.:|        |..:..|.|  .||||.:|
 Frog   139 AWYNEVKD--------YDYNKPGFKAATGHFTQVV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 30/130 (23%)
LOC100497187XP_017945658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.