DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and r3hdml

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:204 Identity:59/204 - (28%)
Similarity:79/204 - (38%) Gaps:57/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTP 155
            :|.|....|||.||..|||:       :..||:|..:.||..|.:.|...|.:|::.|       
 Frog    58 ISPRDMSALLDYHNQVRSKV-------FPPAANMEYMVWDERLAKSAESWANQCKWDH------- 108

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKS---FVINWFREHQDANQSFIDRYHPHPQ---------- 207
                 |.|....:||:....||.|.:|   .|..|:.|.|  :.||     |||:          
 Frog   109 -----GPNQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQ--HYSF-----PHPRECNPSCPNKC 161

  Fly   208 -GKKIGHFTLLVSDRVNRVGCA----------GVRFLEPKSNRFQFMLTCNYDY-NNIFNEPIYQ 260
             |....|:|.:|....||:|||          |..:      |....|.|||.. .|...|..|:
 Frog   162 TGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTW------RQASYLVCNYSIKGNWIGEAPYK 220

  Fly   261 SGPAGSKCP 269
            .|...|.||
 Frog   221 LGRPCSACP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 49/176 (28%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 49/176 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.