DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and glipr2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001107504.1 Gene:glipr2 / 100135358 XenbaseID:XB-GENE-5758336 Length:441 Species:Xenopus tropicalis


Alignment Length:261 Identity:59/261 - (22%)
Similarity:84/261 - (32%) Gaps:73/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLAR 107
            ||.|:.|....|....|.||.         |.:.:.||........||        .|..:|:.|
 Frog    84 TPVSNTGTSPTARGTSYLGTR---------GTDSALSPTADSREFALE--------FLKANNVYR 131

  Fly   108 SKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGRE 172
            |:..:..|. ..|.......||...|..:..|  |....:|            |:||   |....
 Frog   132 SRHGAKPLQ-LNSKISQEAQRWAEHLLNLKNL--KHSDTSH------------GENI---WAKSG 178

  Fly   173 FKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGK-KIGHFTLLVSDRVNRVGCAGVRFLEPK 236
            ..|.:...:....:|::|.::.|.|       .|..| |.||||.:|......|| .|:    ..
 Frog   179 GPSITVTGQEVADSWYKEEKNYNFS-------KPGNKAKTGHFTQMVWKASKEVG-VGL----AS 231

  Fly   237 SNRFQFMLTCNYD-YNNIFNEPIYQSG--PAGSKCPQHRISEKFPSLCDWRDANNDLDSEESDED 298
            |.:...::...|: ..||.|...|...  |.|||                      :..:..|||
 Frog   232 SGKGMLIVVAQYNPSGNITNPGFYGRNVLPRGSK----------------------VTDDGGDED 274

  Fly   299 G 299
            |
 Frog   275 G 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 33/153 (22%)
glipr2NP_001107504.1 SCP <3..69 CDD:294090
SCP_GAPR-1_like 118..249 CDD:240182 36/168 (21%)
SCP_GAPR-1_like 295..426 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.