DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and XB5812873

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:235 Identity:59/235 - (25%)
Similarity:82/235 - (34%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMS---ERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC 151
            |||   |..|..::|.||..||.:..       .||.|..:.||......|...|..|.|.|...
 Frog    58 EMSTDLESNRNFIVDKHNYYRSWVNP-------PAADMLKMHWDNYYLAKAKEWALTCSFKHSNL 115

  Fly   152 RNTPRFK-----FSGQNIGYFWIGREFKSHSRRMKSFVIN-WFREHQDANQSFIDRYHPHPQGKK 210
                .|:     |:|:||        ..|:.|....:||| ||.||  .|..:  ......:|..
 Frog   116 ----SFRQYGGEFAGENI--------MNSYFRHSWEYVINYWFNEH--VNWEY--AVGTTKEGAV 164

  Fly   211 IGHFTLLVSDRVNRVGCAGVR------------FLEPKSNR-------FQFMLTCNYDYNNIFNE 256
            .||||.::....:.:.|...:            ...|..||       :|...||.....:..::
 Frog   165 TGHFTQIIWAPTHALACYVAKCYGTPYNYFYVCIYYPTGNREDKVKTPYQNGTTCGLCQKDCDDQ 229

  Fly   257 ------PIYQS-GPAGSKCPQHRISEKFPSLCDWRDANND 289
                  |.|.| |..|        ::|..||||:.|...|
 Frog   230 LCLNYCPYYNSAGNCG--------TDKNASLCDYSDIGCD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 43/177 (24%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 37/158 (23%)
Crisp 219..269 CDD:400739 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.