DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and R3hdml

DIOPT Version :10

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:198 Identity:54/198 - (27%)
Similarity:80/198 - (40%) Gaps:45/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTP 155
            :|.|....|||.||..|:.:       :..||:|..:.||.:|.:.|...|.:|.:.|..   :.
Mouse    58 ISARDMSALLDYHNHIRASV-------HPPAANMEYMVWDEQLARSAEAWATQCIWTHGP---SQ 112

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKS---FVINWFREHQDANQSFIDRYHPHPQ---------- 207
            ..|:.|||:..         ||.|.:|   .|.:|..|.:  :.||     |.|:          
Mouse   113 LMKYVGQNLSI---------HSGRFRSVVDLVRSWSEEKR--HYSF-----PAPKDCTPHCPWLC 161

  Fly   208 -GKKIGHFTLLVSDRVNRVGCA--GVRFLEPKSNRFQ--FMLTCNYDY-NNIFNEPIYQSGPAGS 266
             |....|:|.:|....:|:|||  ....:....|.:|  ..|.|||.. .|...|..|::|...|
Mouse   162 SGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCS 226

  Fly   267 KCP 269
            .||
Mouse   227 ACP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 CAP_euk 96..249 CDD:349399 44/170 (26%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 44/170 (26%)

Return to query results.
Submit another query.