DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc12Ea and Krt78

DIOPT Version :9

Sequence 1:NP_001368944.1 Gene:Muc12Ea / 32384 FlyBaseID:FBgn0052602 Length:3321 Species:Drosophila melanogaster
Sequence 2:XP_017450824.1 Gene:Krt78 / 315324 RGDID:1591341 Length:1013 Species:Rattus norvegicus


Alignment Length:78 Identity:17/78 - (21%)
Similarity:24/78 - (30%) Gaps:31/78 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IVPGQKPNEIVLHFRNPCNNKTSTTTLKPPPPPCPSHPTTPACEH--RITSPAPTKPHCPHATAT 87
            ||||::           |..:.:.     |...|....|.|..|:  ::|.|.            
  Rat   820 IVPGRE-----------CGGQVTM-----PGRECGGQVTVPGREYGGQVTMPG------------ 856

  Fly    88 PHNCGHDTTSSSR 100
             ..||...|.|.|
  Rat   857 -RECGGQVTVSGR 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc12EaNP_001368944.1 PHA03247 <175..670 CDD:223021
PHA03247 <659..1197 CDD:223021
PHA03247 <1049..1651 CDD:223021
PHA03247 <1723..2186 CDD:223021
PHA03247 <2110..2706 CDD:223021
Krt78XP_017450824.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44684
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.