DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and alaC

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_416880.1 Gene:alaC / 946850 ECOCYCID:G7242 Length:412 Species:Escherichia coli


Alignment Length:411 Identity:94/411 - (22%)
Similarity:165/411 - (40%) Gaps:103/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NIVESLKIKPNPE-KPMIPLSIGDPTTFGNLKAADETMKAVLHSL----ESGKYNGYASTQGHEI 155
            ||...||:..... :.:|..|:|:|.        ..|...::..|    :....:||::::|...
E. coli    22 NITAELKMAARRRGEDIIDFSMGNPD--------GATPPHIVEKLCTVAQRPDTHGYSTSRGIPR 78

  Fly   156 ARKAVAKYSAHQRPDGEID-ANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQGL 219
            .|:|:::: ...|.|.||| .:|.::..|....|.:.:||..|.|..||||.|.:.::...|...
E. coli    79 LRRAISRW-YQDRYDVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIA 142

  Fly   220 DIEVRYYDLLPDQQWRADLVQLESLIDEN---TAALLINNPSNPCGSVFDEKHLRELIAICERHY 281
            ..:||...|:....:   ..:||..|.|:   ...:::..||||.....:.:...:::|:.:|:.
E. coli   143 GAQVRSVPLVEGVDF---FNELERAIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYD 204

  Fly   282 LPIIADEIYEHFVF-----------PGSKHLAVSSLTTEVPVLSCGGLTKRFLVPGWRMGWIIVH 335
            :.::.|..|...|:           ||::.:||...|          |:|.:.:.|||:|:::  
E. coli   205 VLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFT----------LSKSYNMAGWRIGFMV-- 257

  Fly   336 DRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSYFD-GVIDVLHSNAMLA------- 392
                                 |:.|:: .||..|     :||.| |....|...|:.|       
E. coli   258 ---------------------GNKTLV-SALARI-----KSYHDYGTFTPLQVAAIAALEGDQQC 295

  Fly   393 -------YKMLKQ--VRGLDPV-----MPNGAMYMMIGVSIERFPE---FKDDTHFVQEMVNEQS 440
                   ||..:.  |:||...     ||..:||:.     .:.||   ......|.::::||..
E. coli   296 VRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVW-----AKIPEPYAAMGSLEFAKKLLNEAK 355

  Fly   441 VFCLPGSCFEYPG--YVRIVL 459
            |...||..|...|  :||..|
E. coli   356 VCVSPGIGFGDYGDTHVRFAL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 94/411 (23%)
AAT_like 112..475 CDD:99734 90/394 (23%)
alaCNP_416880.1 PRK08175 8..402 CDD:181268 94/411 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1408
SwiftOrtho 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.