DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ybdL

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_415133.1 Gene:ybdL / 945211 ECOCYCID:G6329 Length:386 Species:Escherichia coli


Alignment Length:383 Identity:91/383 - (23%)
Similarity:148/383 - (38%) Gaps:75/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PMIPLS----IGDPTTFGNLKAADETMKAV-------------------LHSLESGKYNGYASTQ 151
            |:||.|    :| .|.|..:.|..:..:|:                   .|.:..|. |.||...
E. coli     5 PLIPQSKLPQLG-TTIFTQMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGA-NQYAPMT 67

  Fly   152 GHEIARKAVAKYSAH---QRPDGEIDANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLY- 212
            |.:..|:|:|:.:..   .:||.:.|   :.:.:|.:.||...|.||...|..|:...|.:..| 
E. coli    68 GVQALREAIAQKTERLYGYQPDADSD---ITVTAGATEALYAAITALVRNGDEVICFDPSYDSYA 129

  Fly   213 --YTLAQGLDIEVRYYDLLPDQQWRADLVQLESLIDENTAALLINNPSNPCGSVFDEKHLRELIA 275
              ..|:.|:   |:...|.| ..:|.|..:..:|:.|.|..:::|.|.||..:|:.:.....|..
E. coli   130 PAIALSGGI---VKRMALQP-PHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQ 190

  Fly   276 ICERHYLPIIADEIYEHFVFPGSKH---LAVSSLTTEVPVLSCGGLTKRFLVPGWRMGWII---- 333
            ....|.:.:|:||:|||..|....|   ||...|......:|..|  |.:.:.||::|:.:    
E. coli   191 AIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFG--KTYHMTGWKVGYCVAPAP 253

  Fly   334 -------VHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSYFDGVIDVLHSNAML 391
                   ||....                ...||..|.||.|:|...|:.|. .:.|.......:
E. coli   254 ISAEIRKVHQYLT----------------FSVNTPAQLALADMLRAEPEHYL-ALPDFYRQKRDI 301

  Fly   392 AYKMLKQVRGLDPVMPNGAMYMMIGVSIERFPEFKDDTHFVQEMVNEQSVFCLPGSCF 449
            ....|.:.| |:.:...|..::::..|.   ....||..|.|.:..|..|..:|.|.|
E. coli   302 LVNALNESR-LEILPCEGTYFLLVDYSA---VSTLDDVEFCQWLTQEHGVAAIPLSVF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 91/383 (24%)
AAT_like 112..475 CDD:99734 90/381 (24%)
ybdLNP_415133.1 PRK09082 1..386 CDD:181642 91/383 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
32.810

Return to query results.
Submit another query.