DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and YER152C

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_011079.3 Gene:YER152C / 856896 SGDID:S000000954 Length:443 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:36/202 - (17%)
Similarity:66/202 - (32%) Gaps:70/202 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 DLVQLESLI----------DENTAALLINNP-----------------SNPCGSVFDEKHLRELI 274
            |.:..||||          ..::...:|..|                 :||.|:.:..:..|.||
Yeast   147 DSIDFESLISALEQHEAEPQPHSTTEMIQGPKLTKKVYRYVMYCIPTFANPSGNTYSLETRRRLI 211

  Fly   275 AICERHYLPIIADEIYEHFVF---------PGSKHLAVSSLTTEVPVLSCGGLT-----KRFLVP 325
            .|..::.:.||.|::|:...:         |..:.:.:...|......|.|...     .:.:.|
Yeast   212 DIARKYDMLIITDDVYDILDYTTPSDELPSPPLRMVHIDRSTAPSGEDSFGNTVSNATFSKLIAP 276

  Fly   326 GWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSYFDGVIDVLHSNAM 390
            |.|.|:   |:..|         .|:..::......:.|..|..|                 |:|
Yeast   277 GLRFGY---HESIN---------ANLARQLSKGGANVSGGTPSQL-----------------NSM 312

  Fly   391 LAYKMLK 397
            :..:||:
Yeast   313 IVGEMLR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 36/202 (18%)
AAT_like 112..475 CDD:99734 36/202 (18%)
YER152CNP_011079.3 ARO8 1..436 CDD:224089 36/202 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.