DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and HIS5

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_012150.1 Gene:HIS5 / 854690 SGDID:S000001378 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:70/307 - (22%)
Similarity:128/307 - (41%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DPTTFGNLKAADETMKAVLHS---LESGKYNGYASTQGHEIARK-AVAKY---SAHQRPDGEI-- 173
            |..|.|.|..|:|.    .|.   :|..|.|.:.....|::..| |:.||   ::....|.|:  
Yeast    24 DDFTEGILLDANEN----AHGPTPVELSKTNLHRYPDPHQLEFKTAMTKYRNKTSSYANDPEVKP 84

  Fly   174 -DANEVVLCSGCSSALEYCILALADRG-QNVLVPRPGFCLYYTLAQGLDIEVRYYDL-LPDQQWR 235
             .|:.:.|..|...:::..|.|....| :.:||..|.:.:|...|...||||....| :.|..::
Yeast    85 LTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGSFQ 149

  Fly   236 AD------LVQLESLIDENTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFV 294
            .|      :::.:|||    ..:.:.:|.||.|:......:.:::...:...  ::.||.|..|.
Yeast   150 MDTEAVLTILKNDSLI----KLMFVTSPGNPTGAKIKTSLIEKVLQNWDNGL--VVVDEAYVDFC 208

  Fly   295 FPGSKHLAVSSLTTEVP-VLSCGGLTKRFLVPGWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGS 358
             .||    .:.|.|:.| :::...|:|.|.:.|.|:|.........|:.:|:....|:..  |.|
Yeast   209 -GGS----TAPLVTKYPNLVTLQTLSKSFGLAGIRLGMTYATAELARILNAMKAPYNISS--LAS 266

  Fly   359 NTIIQGALPDILTKTPQSYFDGVIDVLHSNAMLAYKMLKQVRGLDPV 405
            ...::......|.|     .:....:::...|   ::||::..||.|
Yeast   267 EYALKAVQDSNLKK-----MEATSKIINEEKM---RLLKELTALDYV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 70/307 (23%)
AAT_like 112..475 CDD:99734 70/307 (23%)
HIS5NP_012150.1 hisC 10..377 CDD:273467 70/307 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.721928 Normalized mean entropy S2031
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.