DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and BNA3

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_012475.3 Gene:BNA3 / 853386 SGDID:S000003596 Length:444 Species:Saccharomyces cerevisiae


Alignment Length:483 Identity:118/483 - (24%)
Similarity:187/483 - (38%) Gaps:95/483 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQQDLVDTTATSSSSRKRSGWEIKGSKLSLNTHNRIRNIVESLKIK-----PNPEKPMIPLSIG- 117
            ||:.:...|...|:||.:   .:.....:.||...:.::......|     .|..:.:|.|..| 
Yeast     2 KQRFIRQFTNLMSTSRPK---VVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGF 63

  Fly   118 ---DPTTFGNLKAADETMKAVLHSLESGKYNGYASTQGH-EIARKAVAKYSAHQRP--DGEIDAN 176
               .|..|    |..|..||    |:....|.|:.|:|. .:....:..||    |  :.|:.|.
Yeast    64 FSYSPPQF----AIKEAQKA----LDIPMVNQYSPTRGRPSLINSLIKLYS----PIYNTELKAE 116

  Fly   177 EVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQGLDIEVRYYDLLP----DQ----- 232
            .|.:.:|.:..:..|::.|.:.|..|:|..|.|..|....:....:|.|..:.|    ||     
Yeast   117 NVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRG 181

  Fly   233 -QWRADLVQLESLIDENTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFP 296
             :|..|..|.|..|...|.|::||.|.||.|.||..:.|..|..||.:|.:.||:||:|||..|.
Yeast   182 EEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFT 246

  Fly   297 GSKHLAVSSLTTEVP--VLSCGGLTKRFLVPGWRMGWI-------IVHDRKNRLRDAIVG---LK 349
            .| ...:::|:.|:.  .|:.|...|.|...|||:||:       :.:..|...|.....   |:
Yeast   247 DS-FTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELLSYAAKAHTRICFASPSPLQ 310

  Fly   350 NMCGRILGSNTIIQGALPDILTKTPQSY------FDGVIDVLHSNAMLAYKMLKQVRGLDPVMPN 408
            ..|     :|:|..........|..|.|      |..:.|.|               ||....|.
Yeast   311 EAC-----ANSINDALKIGYFEKMRQEYINKFKIFTSIFDEL---------------GLPYTAPE 355

  Fly   409 GAMYMMIGVSIERFPEFKDDTHFVQEMVNEQSVFCLPGSCFEYPGYVRIVLTVPGAMIEEACSRI 473
            |..::::..|..:.||   |..:.:|::|:...|.:........|.|.|..|             
Yeast   356 GTYFVLVDFSKVKIPE---DYPYPEEILNKGKDFRISHWLINELGVVAIPPT------------- 404

  Fly   474 AEFCDRHYKKESRNFIEHGLLDCDDVAF 501
             ||..:.::|.:.|.:...:  |.|.|:
Yeast   405 -EFYIKEHEKAAENLLRFAV--CKDDAY 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 107/441 (24%)
AAT_like 112..475 CDD:99734 101/397 (25%)
BNA3NP_012475.3 AspB 54..444 CDD:223513 108/428 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.