DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ALT2

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_010396.1 Gene:ALT2 / 851690 SGDID:S000002518 Length:507 Species:Saccharomyces cerevisiae


Alignment Length:501 Identity:118/501 - (23%)
Similarity:201/501 - (40%) Gaps:116/501 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QQDLVDTTATSSSSRKRSGWEIKGSKLSLNT---------HNRIRNIVESLK--IKPNPE----K 109
            ||||...........|.:|   |.:|..|||         ...|....:.||  :|.|||    .
Yeast     6 QQDLKGVFTAKDLDFKPAG---KITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFD 67

  Fly   110 PMIPLSIGD-------PTTFG-----------------------NLKAAD--ETMKAVLHSLESG 142
            .:|..:||:       |.||.                       ||.:.|  |..:.:|:.: .|
Yeast    68 DIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDI-GG 131

  Fly   143 KYNGYASTQGHEIARKAVAKYSAHQRPDGE-IDANEVVLCSGCSSALEYCI-LALADRGQNVLVP 205
            ....|:.:||....|:.||.:.. :|..|| ....::.|.:|.|||....: |...|....:|:|
Yeast   132 SIGAYSHSQGVPGIRQTVADFIT-RRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIP 195

  Fly   206 RPGFCLYYTLAQGLDIEVRYYDLLPDQQWRADLVQLESLIDE------NTAALLINNPSNPCGSV 264
            .|.:.||...|...:.:|..|.|..:..|..:..::|.::.:      ..:.|::.||.||.|:|
Yeast   196 IPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAV 260

  Fly   265 FDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVSSLTTE-----------VPVLSCGGL 318
            ..|:.:..:..|..::.:.||:||:|:..:|...|..::..:..:           |.:.|...:
Yeast   261 LSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSI 325

  Fly   319 TKRFLVP-GWRMGWIIVHDRKNRLRDAIVGLK--NMCGRILGSNTIIQGALPDILTKTPQ----S 376
            :|.|:.. |.|.|::.:......:|||:..|.  ::|..:.|.      |:.|::.|.||    |
Yeast   326 SKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQ------AVVDLMVKPPQPGDES 384

  Fly   377 Y---FDGVIDVLH---SNAMLAYKMLKQVRGLDPVMPNGAMYMMIGVSIERFPE----------- 424
            |   .|..:.:.|   :.|.|.|:..|::.|::...|.||||:        ||.           
Yeast   385 YEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYL--------FPRLVLPKKALCES 441

  Fly   425 ----FKDDTHFVQEMVNEQSVFCLPGSCF-EYPG--YVRIVLTVPG 463
                .:.|..:...::....:..:|||.| :.||  :||.....||
Yeast   442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPG 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 112/482 (23%)
AAT_like 112..475 CDD:99734 100/434 (23%)
ALT2NP_010396.1 PTZ00377 26..505 CDD:240391 111/478 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.