DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ALT1

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_013190.1 Gene:ALT1 / 850778 SGDID:S000004079 Length:592 Species:Saccharomyces cerevisiae


Alignment Length:411 Identity:102/411 - (24%)
Similarity:187/411 - (45%) Gaps:79/411 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LKAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDGEID-ANEVVLCSGCSSAL 188
            :|.|...|:.:     .|....|:|:||.|..||:||::.. :|.:|||. ..::.|.:|.|:|:
Yeast   204 IKRAKSLMEDI-----GGSVGAYSSSQGVEGIRKSVAEFIT-KRDEGEISYPEDIFLTAGASAAV 262

  Fly   189 EYCILALADRG--QNVLVPRPGFCLY-YTLAQGLDIEVRYYDLLPDQQWRADLVQLESLIDE--- 247
            .| :|::..||  ..||:|.|.:.|| .|||......:.|| |..:..|..:..::|:::.|   
Yeast   263 NY-LLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYY-LDENSGWSTNPEEIETVVKEAIQ 325

  Fly   248 ---NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSK---------H 300
               ....|::.||.||.|:|...:.:.::..:..::...:||||:|:..:|||:|         |
Yeast   326 NEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRH 390

  Fly   301 L-----------AVSSLTTEVPVLS--CGGLTKRFLVPGWRMGWIIVHDRKNRLRDAIVGLK--N 350
            |           .::||.:....:|  |          |.|.|::.:....:.:|..|:.|.  :
Yeast   391 LQREHPGKFDNVQLASLHSTSKGVSGEC----------GQRGGYMELTGFSHEMRQVILKLASIS 445

  Fly   351 MCGRILGSNTIIQGALPDILTKTP----------QSYFDGVIDVLHSNAMLAYKMLKQVRGLDPV 405
            :|..:.|.      ||.|::.:.|          |:..:.:.:.|.:.||..|:....:.|::..
Yeast   446 LCPVVTGQ------ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQ 504

  Fly   406 MPNGAMYMMIGVSI-------ERFPEFKDDTHFVQEMVNEQSVFCLPGSCF-EYPG--YVRIVLT 460
            .|.||||:...:.:       .|..|...|..:.::::....:..:|||.| :.||  ::|....
Yeast   505 KPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFL 569

  Fly   461 VPG-AMIEEACSRIAEFCDRH 480
            .|| ..|::..|...||.|::
Yeast   570 APGLEWIKKWESFHKEFFDQY 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 102/411 (25%)
AAT_like 112..475 CDD:99734 99/404 (25%)
ALT1NP_013190.1 PTZ00377 111..590 CDD:240391 102/409 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.