DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and GPT2

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_597700.1 Gene:GPT2 / 84706 HGNCID:18062 Length:523 Species:Homo sapiens


Alignment Length:549 Identity:122/549 - (22%)
Similarity:220/549 - (40%) Gaps:114/549 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RASCTSRSPS---EPESPAPVTPNCDVVDQALAELQLQSQDIRKQQDLVDTTATSSSSRKRSGWE 80
            |..|..|:||   ..:|.|..        :|.|.|:::.:..|:::.|  |..:.:...|...:.
Human     9 RRGCGPRTPSSWGRSQSSAAA--------EASAVLKVRPERSRRERIL--TLESMNPQVKAVEYA 63

  Fly    81 IKG------SKLSLNTHNRIRNIVESLKIKPNPEKPMIPLSIGD-------PTTF---------- 122
            ::|      .::.|.....|:        ||..|  :|..:|||       |.||          
Human    64 VRGPIVLKAGEIELELQRGIK--------KPFTE--VIRANIGDAQAMGQQPITFLRQVMALCTY 118

  Fly   123 GNL-------KAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDGEI--DANEV 178
            .||       :.|.:..:.:|.:........|:::||....|:.||.|..  |.||.:  |.:.:
Human   119 PNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYIT--RRDGGVPADPDNI 181

  Fly   179 VLCSGCSSALEYCILALADRG----QNVLVPRPGFCLYYTLAQGLD-IEVRYYDLLPDQQWRADL 238
            .|.:|.|..:...:..|...|    ..|::|.|.:.||..:...|| |:|.|| |..:..|..::
Human   182 YLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYY-LDEENCWALNV 245

  Fly   239 VQLESLIDE-----NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVF-PG 297
            .:|...:.|     :...|.|.||.||.|.|...|.:.::|.......|.::|||:|:..|: |.
Human   246 NELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPD 310

  Fly   298 SKHLAVSSL--------TTEVPVLSCGGLTKRFLVP-GWRMGWIIVHDRKNRLRDAIVGLKN--M 351
            .:..:...:        ::.|.:.|....:|.::.. |:|.|::.|.:....::..:|.|.:  :
Human   311 CRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRL 375

  Fly   352 CGRILGSNTIIQGALPDILTKTP----QSY------FDGVIDVLHSNAMLAYKMLKQVRGLDPVM 406
            |..:.|     |.|: ||:...|    :|:      .:.|:..|...|.|...:..||.|:....
Human   376 CPPVSG-----QAAM-DIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNP 434

  Fly   407 PNGAMYMM-------IGVSIERFPEFKDDTHFVQEMVNEQSVFCLPGSCF---EYPGYVRIVLTV 461
            ..||||..       ..|...:..:...|..:..:::.|..:..:|||.|   |...:.|:.:..
Human   435 LQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILP 499

  Fly   462 PGAMIEEACSRIAEFCDRHYKKESRNFIE 490
            |...::....::.:|   |.     ||:|
Human   500 PVEKLKTVLQKVKDF---HI-----NFLE 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 104/475 (22%)
AAT_like 112..475 CDD:99734 97/430 (23%)
GPT2NP_597700.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 5/15 (33%)
PTZ00377 48..523 CDD:240391 111/502 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.