DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ACCS

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_005253227.2 Gene:ACCS / 84680 HGNCID:23989 Length:602 Species:Homo sapiens


Alignment Length:357 Identity:90/357 - (25%)
Similarity:148/357 - (41%) Gaps:70/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 YASTQGHEIARKAVAKYSAHQ-------RPDGEIDANEVVLCSGCS--SALEYCILALADRGQNV 202
            ||..:||...|:.|||:.:..       ||:     |.|||..|.|  |||   ...|.:.|:..
Human   233 YADWRGHLFLREEVAKFLSFYCKSPVPLRPE-----NVVVLNGGASLFSAL---ATVLCEAGEAF 289

  Fly   203 LVPRPGF-------CLYYTLAQG---LDIEVRYYDLLPDQQWRADLVQLESLIDE------NTAA 251
            |:|.|.:       |||..:...   ||.||...|..|   ::..:.:||..:.|      ....
Human   290 LIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRP---FQLTVEKLEMALREAHSEGVKVKG 351

  Fly   252 LLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGS----KHLAVSSLTTEVPV 312
            |::.:|.||.|.|:..:.|:|.:...:||.|.:|.||:|...||..|    ..|::..|......
Human   352 LILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRT 416

  Fly   313 LSCGGLTKRFLVPGWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSY 377
            ......:|.|.:.|.|.|.:...:     :|....:.::| |..|.:.::|..:..:|...    
Human   417 HVMWATSKDFGMSGLRFGTLYTEN-----QDVATAVASLC-RYHGLSGLVQYQMAQLLRDR---- 471

  Fly   378 FDGVIDVL----HSNAMLAYKML-KQVRGLD-PVMPNGAMYMMIGVSIERF-PEFKDDTHFVQEM 435
             |.:..|.    |:....|:..: :::|.|. |.:..||.: .|.|.:.:: |:    ..|.:||
Human   472 -DWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGF-FIWVDLRKYLPK----GTFEEEM 530

  Fly   436 V-----NEQSVFCLPGSCFE--YPGYVRIVLT 460
            :     .:..|....|..||  .||:.|.|.:
Human   531 LLWRRFLDNKVLLSFGKAFECKEPGWFRFVFS 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 90/357 (25%)
AAT_like 112..475 CDD:99734 90/357 (25%)
ACCSXP_005253227.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.