DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ACS5

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_201381.1 Gene:ACS5 / 836709 AraportID:AT5G65800 Length:470 Species:Arabidopsis thaliana


Alignment Length:487 Identity:108/487 - (22%)
Similarity:184/487 - (37%) Gaps:114/487 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VDTTATSSSSRKRS----GWEIKGSKLSLNTHNRIRNIVESLKIKPNPEKPMIPLSIGDPTTFGN 124
            :.|..||:...:.|    |||    :...|.::.|:|        ||   .||.:.:.:.....:
plant     4 LSTKVTSNGHGQDSSYFLGWE----EYEKNPYDEIKN--------PN---GMIQMGLAENQLCFD 53

  Fly   125 LKAADETMKAVLHSLESGKYNG---------YASTQGHEIARKAVAKYSAHQRPDG-EIDANEVV 179
            |..:..|......||   |.||         :....|....:||:|::....|.:. ..|..::|
plant    54 LIESWLTKNPDAASL---KRNGQSIFRELALFQDYHGMPEFKKAMAEFMEEIRGNRVTFDPKKIV 115

  Fly   180 LCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQGLDIEVRYYDLLPDQQWR--ADLV--- 239
            |.:|.:||.|..:..||:.|...|:|.|    ||   .|.|         .|.:||  |::|   
plant   116 LAAGSTSANETLMFCLAEPGDAFLLPTP----YY---PGFD---------RDLKWRTGAEIVPIH 164

  Fly   240 ------------------QLESLIDENTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIA 286
                              |....:|.....:|:.|||||.|:....:.|..|:.......:.:|:
plant   165 CSSSNGFQITESALQQAYQQAQKLDLKVKGVLVTNPSNPLGTALTRRELNLLVDFITSKNIHLIS 229

  Fly   287 DEIYEHFVFPGSKHLAVSSL-------TTEVP--VLSCGGLTKRFLVPGWRMGWIIVHDRKNRLR 342
            ||||...:|...:.::|..:       .|||.  |.....|:|...:||:|:|.|..:|      
plant   230 DEIYSGTMFGFEQFISVMDVLKDKKLEDTEVSKRVHVVYSLSKDLGLPGFRVGAIYSND------ 288

  Fly   343 DAIV--GLKNMCGRILGSNT--IIQGALPDILTKTPQSYFDGVIDVLHSNAMLAYKMLKQVRGLD 403
            :.||  ..|.....::.|.|  ::...|.|  .|....|.:      .:...|..:..:.|.||:
plant   289 EMIVSAATKMSSFGLVSSQTQYLLSALLSD--KKFTSQYLE------ENQKRLKSRQRRLVSGLE 345

  Fly   404 P-----VMPNGAMYMMIGV-SIERFPEFKDDTHFVQEMVNEQSVFCLPGS---CFEYPGYVRIVL 459
            .     :..|..::..:.: .:.....|:.:....:::|....:...|||   |.| ||:.|:..
plant   346 SAGITCLRSNAGLFCWVDMRHLLDTNTFEAELDLWKKIVYNVKLNISPGSSCHCTE-PGWFRVCF 409

  Fly   460 -TVPGAMIEEACSRIAEF-----CDRHYKKES 485
             .:....::.|..|:..|     |.|...:.|
plant   410 ANMSEDTLDLALKRLKTFVESTDCGRMISRSS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 102/462 (22%)
AAT_like 112..475 CDD:99734 91/418 (22%)
ACS5NP_201381.1 PLN02450 1..469 CDD:178069 108/487 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.