DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ACS12

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_199982.2 Gene:ACS12 / 835243 AraportID:AT5G51690 Length:495 Species:Arabidopsis thaliana


Alignment Length:534 Identity:103/534 - (19%)
Similarity:209/534 - (39%) Gaps:149/534 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSSFANESQFRYQSSRNRASCTSRSPSEPESPAPVTPNCDVVDQALAELQLQSQDIRKQQDLVD 65
            :|.:|:..:.|...:|..|...:||:       .||....|                        
plant    48 LPRTFSRTNLFSRGNSIGRVRVSSRA-------VPVAKPSD------------------------ 81

  Fly    66 TTATSSSSRKRSGWEIKGSKLSLNTHNRIRNIVESLKIKPNPEKPMIPLSIGDPTTFGNLK---A 127
                       |.:.|...::..:.::||.|           ...:|.|.:.:.|...:|.   .
plant    82 -----------SPYYIGLERVKTDPYDRITN-----------TDGIIQLGLAESTLCFDLLQRWM 124

  Fly   128 ADETMKAVLHSLESGKYN-----GYASTQGHEIARKAVAKY-SAHQRPDGEIDANEVVLCSGCSS 186
            ::..|::::.| :.|:::     .|...:|....|.|.|.: |.....:...|.:.:|:.:|.:.
plant   125 SENLMESMMQS-DDGEFDISSIAMYKPFEGLLELRVAFADFMSRIMGGNVSFDPSNMVITAGGTP 188

  Fly   187 ALEYCILALADRGQNVLVPRPGFCLYYTLAQGLDIEVRY---YDLLP-----DQQWRADLVQLES 243
            |:|.....|||.|...|:|.|    ||   .|.|.::::   .:|:|     ...:...:..||.
plant   189 AIEVLAFCLADHGNAFLIPTP----YY---PGFDRDIKFRTGVELIPVHCRSSDNFTVTVSALEQ 246

  Fly   244 LIDE------NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLA 302
            .:::      ..:.:|.:|||||.|::...:.|.:::...:...:.:|:|||:...|:...:.::
plant   247 ALNQARKRGSKVSGILFSNPSNPVGNILSRETLCDILRFAQEKNIHVISDEIFAGSVYGDKEFVS 311

  Fly   303 VSSLT-------TEVPVLSCGGLTKRFLVPGWRMGWI------IVHDRKNRLRDAIVGLKNMCGR 354
            ::.:.       |.|.::.  ||:|...:||:|.|.|      :|:..|..:|.:.|.:      
plant   312 MAEIAGSGEFDKTRVHIIY--GLSKDLSIPGFRAGVIYSFHEDVVNAAKKLMRFSSVPV------ 368

  Fly   355 ILGSNTIIQGALPDILTKTPQSYFDGVIDVLHSNAMLAYKM------------LKQVRGLDPVMP 407
                  ::|..|..:|:..  .:.:|.        |.|::.            |||: |:.....
plant   369 ------LVQRILISLLSDV--RFIEGY--------MAAHRQRIRDKHIRFVEGLKQL-GIPCAES 416

  Fly   408 NGAMYMMIGVS--IERFPEFKDDTHFVQEMVNEQSVFCLPGS---CFEYPGYVRIVLT------V 461
            .|.:|..:.:|  :..:.| |.:....::::....:...||:   |.| ||:.|...|      :
plant   417 GGGLYCWVDMSSLLTSYSE-KGELELFEKLLTVAKINATPGTACYCIE-PGWFRCCFTALADEDI 479

  Fly   462 PGAMIEEACSRIAE 475
            |  :|.|...::||
plant   480 P--VIMERIRQLAE 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 92/456 (20%)
AAT_like 112..475 CDD:99734 86/421 (20%)
ACS12NP_199982.2 PLN02450 70..495 CDD:178069 98/512 (19%)
AAT_I 81..213 CDD:302748 33/185 (18%)
AAT_like 148..488 CDD:99734 79/375 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.