DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ACS7

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_194350.1 Gene:ACS7 / 828726 AraportID:AT4G26200 Length:447 Species:Arabidopsis thaliana


Alignment Length:434 Identity:101/434 - (23%)
Similarity:173/434 - (39%) Gaps:107/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NIVESLKIKPNPEKPMIPLSIGDP--------TTFGNLKAADETMKAVLHSLESGKYNGYASTQG 152
            :::|:...|.|||..|.. |.|.|        ..:..||...:.|.:.:..:..||         
plant    67 DLLETYLEKKNPEGSMWG-SKGAPGFRENALFQDYHGLKTFRQAMASFMEQIRGGK--------- 121

  Fly   153 HEIARKAVAKYSAHQRPDGEIDANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQ 217
                              ...|.:.:||.:|.::|.|.....|||....:|||.|    ||   .
plant   122 ------------------ARFDPDRIVLTAGATAANELLTFILADPNDALLVPTP----YY---P 161

  Fly   218 GLDIEVR----------------YYDLLPDQQWRADLVQLESLI----DEN--TAALLINNPSNP 260
            |.|.::|                ::.:.|:        .|||..    |.|  ...:||.|||||
plant   162 GFDRDLRWRTGVKIVPIHCDSSNHFQITPE--------ALESAYQTARDANIRVRGVLITNPSNP 218

  Fly   261 CGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVSSLTTEVPVLSCG-------GL 318
            .|:...:|.|.:|:..|.|..:.:::||||...||..|:..:|:.:...:..:|..       .|
plant   219 LGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFHASEFTSVAEIVENIDDVSVKERVHIVYSL 283

  Fly   319 TKRFLVPGWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTK--TPQSYFDGV 381
            :|...:||:|:|.|..:: .|.:|.|         |.:.|.|::......:|..  :.:.:.:..
plant   284 SKDLGLPGFRVGTIYSYN-DNVVRTA---------RRMSSFTLVSSQTQHMLASMLSDEEFTEKY 338

  Fly   382 IDVLHSNAMLAY----KMLKQVRGLDPVMPNGAMY--MMIGVSIERFPEFKD-DTHFVQEMVNEQ 439
            |.:........|    :.||:. |::.:..|..::  |.:|..:|:  :.|| :......::.|.
plant   339 IRINRERLRRRYDTIVEGLKKA-GIECLKGNAGLFCWMNLGFLLEK--KTKDGELQLWDVILKEL 400

  Fly   440 SVFCLPGS---CFEYPGYVRIVL-TVPGAMIEEACSRIAEFCDR 479
            ::...|||   |.|. |:.|:.. .:....:|.|..||.||.||
plant   401 NLNISPGSSCHCSEV-GWFRVCFANMSENTLEIALKRIHEFMDR 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 101/434 (23%)
AAT_like 112..475 CDD:99734 91/412 (22%)
ACS7NP_194350.1 PLN02607 6..447 CDD:215327 101/434 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.