DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and ACS1

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_191710.1 Gene:ACS1 / 825324 AraportID:AT3G61510 Length:488 Species:Arabidopsis thaliana


Alignment Length:498 Identity:106/498 - (21%)
Similarity:184/498 - (36%) Gaps:129/498 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QQDLVDTTATSSSSRKRS----GWEIKGSKLSLNTHNRIRNIVES-----------LK--IKPNP 107
            :..|:...|.|....:.|    ||:...:.....|||. :.:::.           :|  ||.||
plant     7 ENQLLSKLALSDKHGEASPYFHGWKAYDNNPFHPTHNP-QGVIQMGLAENQLCSDLIKEWIKENP 70

  Fly   108 EKPMIPLSIGDPTTFGNLKAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDGE 172
            :..:.       |..|....:|..:....|.|:.              .|:|:|.:....| .|.
plant    71 QASIC-------TAEGIDSFSDIAVFQDYHGLKQ--------------FRQAIATFMERAR-GGR 113

  Fly   173 I--DANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQGLDIEVRYYDLLPDQQWR 235
            :  :|..||:..|.:.|.|..:..|||.|...|||.|    ||..          :|  .|.:||
plant   114 VRFEAERVVMSGGATGANETIMFCLADPGDAFLVPTP----YYAA----------FD--RDLRWR 162

  Fly   236 AD--LVQLESLIDEN---------------------TAALLINNPSNPCGSVFDEKHLRELIAIC 277
            ..  ::.:|.....|                     ...|:|   |||.|:..|.:.|..|::..
plant   163 TGVRIIPVECSSSNNFQITKQALESAYLKAQETGIKIKGLII---SNPLGTSLDRETLESLVSFI 224

  Fly   278 ERHYLPIIADEIYEHFVFPGSKHLAVSSLTTEVPVLS------CGGLTKRFLVPGWRMGWIIVHD 336
            ....:.::.||||...||.....::|:.:..|:..::      ...|:|...:||:|:|.:..::
plant   225 NDKQIHLVCDEIYAATVFAEPGFISVAEIIQEMYYVNRDLIHIVYSLSKDMGLPGFRVGVVYSYN 289

  Fly   337 RKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTK--TPQSYFDGVIDVLHSNAMLAYKMLK-- 397
                  |.:|.    |.|.:.|..::.......|..  :.||:.|..:..:.......:.|..  
plant   290 ------DVVVS----CARRMSSFGLVSSQTQSFLAAMLSDQSFVDNFLVEVSKRVAKRHHMFTEG 344

  Fly   398 -QVRGLDPVMPNGAMYMMIGVSIERFPEFKDDTHFVQEM------VNEQSVFCLPGSCF--EYPG 453
             :..|:..:..|..:::::.:.    ...||.| |..||      :|:..:...|||.|  ..||
plant   345 LEEMGISCLRSNAGLFVLMDLR----HMLKDQT-FDSEMALWRVIINKVKINVSPGSSFHCSEPG 404

  Fly   454 YVRIVLTVPGAMIEE-----ACSRIAEFC--DRHYKKESRNFI 489
            :.|:..    |.::|     |..||.:|.  ||..|.::.|.|
plant   405 WFRVCF----ANMDEDTLQIALERIKDFVVGDRANKNKNCNCI 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 98/465 (21%)
AAT_like 112..475 CDD:99734 86/411 (21%)
ACS1NP_191710.1 PLN02994 3..154 CDD:166635 40/173 (23%)
PLN02376 4..488 CDD:178004 106/498 (21%)
AAT_like 89..427 CDD:99734 83/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.