DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and gpt2

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001092227.2 Gene:gpt2 / 799963 ZFINID:ZDB-GENE-030729-8 Length:484 Species:Danio rerio


Alignment Length:424 Identity:104/424 - (24%)
Similarity:173/424 - (40%) Gaps:82/424 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IRNIVESLKIKPNPEKPMIPLSIGD-------PTTFGNLKAA----DETMKA------------- 134
            |...:|....||..|  :|..:|||       |.||.....|    .|.|::             
Zfish    33 IERCLEEGGTKPFSE--VIKANIGDAHAMGQQPITFLRQVVALCTFPELMESPSFPEDAKWRARR 95

  Fly   135 VLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDGEIDAN--EVVLCSGCSSALEYCILALAD 197
            :|..........|:::.|.|..||.:|.| ..||.:| :.:|  ::.|.:|.|..: ..||.|..
Zfish    96 ILQGCGGHSLGSYSASAGVEYIRKDIAAY-IEQRDEG-VPSNWEDIYLTTGASDGI-MTILRLLV 157

  Fly   198 RGQN-----VLVPRPGFCLYYTLAQGLD-IEVRYYDLLPDQQWRADLVQLESLIDE-----NTAA 251
            .|::     |::|.|.:.||......:| ::|.|| |..|..|..|:.:|......     ....
Zfish   158 SGKDSSRTGVMIPIPQYPLYSAAISEMDAVQVNYY-LDEDNCWALDINELHRAYQAAKQHCQPRV 221

  Fly   252 LLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVF-PGSKHLAVSSLTTE------ 309
            :.|.||.||.|.|..:|.:.|::.......|.:::||:|:..|: |..:..:...:..|      
Zfish   222 ICIINPGNPTGQVQSKKCIEEVLHFAYEENLFVMSDEVYQDNVYAPDCQFHSFKKVLYEMGPEYY 286

  Fly   310 --VPVLSCGGLTKRFLVP-GWRMGWIIVHDRKNRLRDAIVGLKN--MCGRILGSNTIIQGALPDI 369
              |.:.|....:|.:... |:|.|::.|.:....::..:|.|.:  :|..:.|     |.|: |:
Zfish   287 NSVELASFHSTSKGYTGECGFRGGYMEVINMDPEVKAQLVKLLSVRLCPPLSG-----QAAM-DV 345

  Fly   370 LTKTPQ----SY------FDGVIDVLHSNAMLAYKMLKQVRGL--DPVMPNGAMYMM--IGVSIE 420
            :...||    ||      ...|:..|...|.|..::|..|.|:  :||  .||||..  |.:..:
Zfish   346 IVNPPQPDEHSYQQFHQEKSSVLGALAEKAKLTEEILNAVPGIKCNPV--QGAMYAFPRIFIPPK 408

  Fly   421 RFPEFK-----DDTHFVQEMVNEQSVFCLPGSCF 449
            ...|.|     .|..:...::.|..:..:|||.|
Zfish   409 AMEEAKTLGMQPDMLYCLRLLEETGICVVPGSGF 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 104/424 (25%)
AAT_like 112..475 CDD:99734 99/406 (24%)
gpt2NP_001092227.2 PTZ00377 2..481 CDD:240391 104/424 (25%)
AAT_like 83..471 CDD:99734 89/372 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.