DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and kyat1

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_998524.2 Gene:kyat1 / 791592 ZFINID:ZDB-GENE-040426-2676 Length:446 Species:Danio rerio


Alignment Length:388 Identity:102/388 - (26%)
Similarity:161/388 - (41%) Gaps:77/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KAVLHSLESG-KYNGYASTQGHEIARKAVAKYSAHQRPDG-EIDANEVVLCS-GCSSALEYCILA 194
            :|..::|..| :.:.|....||....|.:||:  ..|..| |||..|.:|.| |...||.....|
Zfish    74 EAFCNALTGGFRMHQYTRAFGHPNLVKILAKF--FSRIVGREIDPMEDILVSVGAYQALFCTFQA 136

  Fly   195 LADRGQNVLVPRPGFCLY---YTLAQGLDIEVRYYDLLPDQ---------QWRADLVQLESLIDE 247
            |.|.|..|::..|.|..|   ..:|.|:.:   |..|.|.:         .|.....:|.|....
Zfish   137 LVDEGDEVIIVEPFFDCYQPMVMMAGGMPV---YVPLKPREGRGPALTSADWVLSPEELASKFTS 198

  Fly   248 NTAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVSSLTTEVP- 311
            .|.|::||.|:||.|.|:..:.|:.:..:|.:|.:..|:||:||...:.|:||:.::||    | 
Zfish   199 RTKAIVINTPNNPLGKVYQWEELQVIADLCIKHDVICISDEVYEWLTYDGAKHVKIASL----PG 259

  Fly   312 ----VLSCGGLTKRFLVPGWRMGWII-----------VHDRK-----NRLRDAI-VGLKNMCGRI 355
                .::.|...|.|...||::||.|           ||...     ...::|| ||.:.... :
Zfish   260 MWERTVTIGSAGKTFSATGWKVGWAIGSGHIMKHLKTVHQNSVYHCATAAQEAISVGFQREYD-V 323

  Fly   356 LGSNTIIQGALPDILTKTPQSYFDGVIDVLHSNAMLAYKMLKQVRGLDPVMPNGAMYMMIGVSIE 420
            .|               |..|||..:...||.........||.| ||.|::|.|..:|:..:|..
Zfish   324 FG---------------TEDSYFHQLPITLHEKRKRLADCLKSV-GLKPILPQGGYFMIADISNI 372

  Fly   421 RF----PEFKD---DTHFVQEMVNEQSVFCLPGSCF-------EYPGYVRIVLTVPGAMIEEA 469
            ..    |..|:   |..||:.::.|:.:..:|.|.|       ::..|:|.......:.::.|
Zfish   373 NVDLNDPTTKEEPYDYRFVKWLIKEKGLATIPVSAFYSPEHRDQFQKYIRFCFVKEDSTLQAA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 102/388 (26%)
AAT_like 112..475 CDD:99734 102/388 (26%)
kyat1NP_998524.2 PRK08912 43..442 CDD:181580 102/388 (26%)
AAT_like 57..441 CDD:99734 102/388 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.