DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and Kyat1

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_006498378.1 Gene:Kyat1 / 70266 MGIID:1917516 Length:573 Species:Mus musculus


Alignment Length:382 Identity:91/382 - (23%)
Similarity:160/382 - (41%) Gaps:86/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 QGHEIARKAVAKYSAHQRPDGEIDANE------VVLCSGCSSALEYCILALADRGQNVLVPRPGF 209
            ||:....|.:|.:.      |::...|      |::..|...||.....||.|.|..|::..|.|
Mouse   216 QGYPPLTKILASFF------GKLLGQEMDPLKNVLVTVGAYGALFTAFQALVDEGDEVIIIEPAF 274

  Fly   210 CLY--YTLAQG---LDIEVRYYDLLP--------DQQWRADLVQLESLIDENTAALLINNPSNPC 261
            ..|  .|:..|   :.:.:|   |.|        ...|:.|..:|.|.....|..|::|.|:||.
Mouse   275 NCYEPMTMMAGGRPVFVSLR---LSPAPKGQLGSSNDWQLDPTELASKFTPRTKILVLNTPNNPL 336

  Fly   262 GSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVSSLTTEVP-----VLSCGGLTKR 321
            |.||.:|.|..:.|:|::|.:...:||:|:..|:.|.:|::::||    |     .|:.|...|.
Mouse   337 GKVFSKKELELVAALCQQHDVLCFSDEVYQWLVYDGHQHISIASL----PGMWERTLTIGSAGKS 397

  Fly   322 FLVPGWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTII------QGALPDILTK------TP 374
            |...||::||::..|..         :|::  |.:..|:|.      |.|:.....:      .|
Mouse   398 FSATGWKVGWVMGPDNI---------MKHL--RTVHQNSIFHCPTQAQAAVAQCFEREQQHFGQP 451

  Fly   375 QSYFDGVIDVLHSNAMLAYKMLKQVRGLDPVMPNGAMYMMIGVSIERFPEFKD------------ 427
            .|||..:...:..|.....:.|:.| ||.|::|.|:.:::..:|     :||.            
Mouse   452 SSYFLQLPQAMGLNRDHMIQSLQSV-GLKPLIPQGSYFLIADIS-----DFKSSMPDLPGAMDEP 510

  Fly   428 -DTHFVQEMVNEQSVFCLPGSCF-------EYPGYVRIVLTVPGAMIEEACSRIAEF 476
             ||.|.:.|:..:.:..:|.|.|       ::..|:|.......|.::....|:..:
Mouse   511 YDTRFAKWMIKNKGLSAIPVSTFYSQPHHKDFDHYIRFCFVKDKATLQAMDKRLCSW 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 91/382 (24%)
AAT_like 112..475 CDD:99734 91/379 (24%)
Kyat1XP_006498378.1 PRK08912 218..569 CDD:181580 89/380 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.