DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and Accsl

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001103064.1 Gene:Accsl / 690470 RGDID:1596039 Length:617 Species:Rattus norvegicus


Alignment Length:423 Identity:90/423 - (21%)
Similarity:166/423 - (39%) Gaps:85/423 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DPTTFGNLKAADETM----------KAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQ-RPDG 171
            :|:.:.||..::..:          :..::.|:..:.. |:..:|....|:.:|.:..|. :...
  Rat   190 NPSGYINLSTSENKLCLDLITARLTQCDMNFLDEAQLQ-YSDWKGEPSLREELASFLTHYCKAPT 253

  Fly   172 EIDANEVVLCSGCSSALEYCILALADRGQNVLVPRP---GFCLYYTLAQGLDIEVRYYDLLPDQQ 233
            .:|...||:.:||||.....::.|.|.|..:|:|.|   ||    |.:..|..:|   :|:|   
  Rat   254 PLDPENVVVLNGCSSVFSSLVMVLCDPGDALLIPTPCYSGF----TFSSYLYSKV---ELIP--- 308

  Fly   234 WRADLVQLESLIDE-------------------------NTAALLINNPSNPCGSVFDEKHLREL 273
                 |.|||.:.|                         ....|::.||.||.|.|:.:..|:|.
  Rat   309 -----VYLESQVTETNKYSFQLTVDKLKLTLTQAKKKGKKVKGLVLINPQNPLGDVYTQGSLQEY 368

  Fly   274 IAICERHYLPIIADEIYEHFVFPGS----KHLAVSSLTTEVPVLSCGGLTKRFLVPGWRMGWIIV 334
            :...::|.|.:|.||||...||..:    ..|::.:|.....:....|.:|.|.:.|.|.|.:..
  Rat   369 LVFAKKHKLHVIMDEIYMLSVFEPTVTFHSILSIENLPDPNMIHMIWGTSKDFGMSGIRFGVLYT 433

  Fly   335 HDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQSYFDGV-IDVLHSNAMLAY----K 394
            |:::      :.......|.....:.|||..|..:|  ..:.:.:.| :...||....||    |
  Rat   434 HNKE------VASAMKAFGYHHSVSGIIQYKLRQLL--QDKEWINKVYLPKNHSRLREAYSYVTK 490

  Fly   395 MLKQVRGLDPVMP----NGAMYMMIGVSIERFPEFKDDTHFVQEMVNEQSVFCLPGS---CFEYP 452
            ||:.::     :|    ...:::.|.:.....|...|....:.:...::.:....|.   |.| |
  Rat   491 MLEDLK-----IPFCNCGSGLFVWINLKAYLNPCTFDQEQILHQRFQDKKLLLSSGKSFMCIE-P 549

  Fly   453 GYVRIVLTVPGAMIEEACSRIAEFCDRHYKKES 485
            |:.|:|.......::.|..:..:....|.|.|:
  Rat   550 GWFRLVFAEKHPQLQVAMGQFCQVLAEHKKGET 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 87/417 (21%)
AAT_like 112..475 CDD:99734 87/411 (21%)
AccslNP_001103064.1 PLN02607 174..586 CDD:215327 90/423 (21%)
AAT_like 195..567 CDD:99734 85/401 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.