DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1461 and KYAT3

DIOPT Version :9

Sequence 1:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001008661.1 Gene:KYAT3 / 56267 HGNCID:33238 Length:454 Species:Homo sapiens


Alignment Length:447 Identity:115/447 - (25%)
Similarity:196/447 - (43%) Gaps:75/447 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SSRKRSGWEIKGSKLSLNTHN--RIRNI-----VESLKIKPNPEKPMIPLSIGDPTTFGNLKAAD 129
            ||.|..|:. ..:|:||...|  ||..:     :|..|:..:|.  ::.|..|.|.........:
Human    22 SSSKILGFS-TSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPS--VVNLGQGFPDISPPTYVKE 83

  Fly   130 ETMK-AVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQRPDGEIDAN-EVVLCSGCSSALEYCI 192
            |..| |.:.||     |.|....||....||:: |...:....:||:| |:::..|...:|...|
Human    84 ELSKIAAIDSL-----NQYTRGFGHPSLVKALS-YLYEKLYQKQIDSNKEILVTVGAYGSLFNTI 142

  Fly   193 LALADRGQNVLVPRPGFCLYYTL-----AQGLDIEVR----YYDLLPDQQWRADLVQLESLIDEN 248
            .||.|.|..|::..|.:..|..:     |..:.|.:|    |........|..|..:|||..:..
Human   143 QALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSK 207

  Fly   249 TAALLINNPSNPCGSVFDEKHLRELIAICERHYLPIIADEIYEHFVFPGSKHLAVSSLTTEVP-- 311
            |.|:::|.|.||.|.|::.:.|:.:..:|.::....|:||:||..|:.|:|||.:::.    |  
Human   208 TKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATF----PGM 268

  Fly   312 ---VLSCGGLTKRFLVPGWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALP--DILT 371
               .::.|...|.|.|.||::||.|   ..|.|      :|::  :.:..|||...|.|  :.|.
Human   269 WERTITIGSAGKTFSVTGWKLGWSI---GPNHL------IKHL--QTVQQNTIYTCATPLQEALA 322

  Fly   372 KT----------PQSYFDGVIDVLHSNAMLAYKMLKQVRGLDPVMPNGAMYMMIGVSIERFPEFK 426
            :.          |:.||:.:...|........::|:.| ||.|::|:|..:::..||: ..|:..
Human   323 QAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV-GLKPIVPDGGYFIIADVSL-LDPDLS 385

  Fly   427 D-------DTHFVQEMVNEQSVFCLPGSCF-------EYPGYVRIVLTVPGAMIEEA 469
            |       |..||:.|...:.:..:|.|.|       ::..:||.......:.::.|
Human   386 DMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAA 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 111/440 (25%)
AAT_like 112..475 CDD:99734 102/400 (26%)
KYAT3NP_001008661.1 PRK07777 44..449 CDD:236095 107/424 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.